Protein Info for SO2357 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details PF13386: DsbD_2" amino acids 13 to 223 (211 residues), 202.4 bits, see alignment E=3.7e-64

Best Hits

KEGG orthology group: K09792, hypothetical protein (inferred from 100% identity to son:SO_2357)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEM2 at UniProt or InterPro

Protein Sequence (234 amino acids)

>SO2357 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MIDTVIEYNVTGAFLVGLMGAAHCFGMCGGLVGAFSSQLPNPKQGNHLAHQLTYLFSYNL
GRILSYTLAGALVGGSSAMLGHLFELDSYLLVLRIFAGIMMIATGLYIAKIWVGIVQIER
LGQVLWRYLKPIAQRLVPITTPMQAITAGLIWGWLPCGLVYSTLTWSVAAGSASQGALIM
LAFGLGTLPALLSAGVAAKRLANWVQQKTVRLLSGLLLIVFGGQTLYIALSQLN