Protein Info for SO2342 in Shewanella oneidensis MR-1

Name: nadA
Annotation: quinolinate synthetase complex, subunit A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 30 to 345 (316 residues), 384.5 bits, E=1.7e-119
• PF02445: NadA
  • amino acids 35 to 344 (310 residues), 352.1 bits, E=1.1e-109

Best Hits

Swiss-Prot: 100% identical to NADA_SHEON: Quinolinate synthase A (nadA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to son:SO_2342)

MetaCyc: 73% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

See Q8EEN5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>SO2342 quinolinate synthetase complex, subunit A (NCBI ptt file) (Shewanella oneidensis MR-1)
MSSSLFAPTIETIDYPFPPKPVPLSDAQKADYKARIKQLLIEKDAVLVAHYYTDPEIQAL
AEETGGCVSDSLEMARFGRDHPAKTLIVAGVKFMGETAKILSPEKTILMPTLEATCSLDL
GCPIDKFSAFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIVEHLDSEGKKIIWGP
DRHLGSYIAKQTGAEMLMWQGDCIVHDEFKANALRDLKSVYPDAAILVHPESPASVVAMA
DAVGSTSQLIKAAQTMPNERFIVATDRGIFYKMQQAAPGKTLIEAPTGGNGATCKSCAHC
PWMAMNGLKAIEASLSNSDKTTHEIFVDEDLRVKALIPLTRMLDFAKTLNMKVKGNA