Protein Info for SO2338 in Shewanella oneidensis MR-1

Name: astE
Annotation: succinylglutamate desuccinylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR03242: succinylglutamate desuccinylase" amino acids 10 to 335 (326 residues), 351.3 bits, see alignment E=2.6e-109 PF24827: AstE_AspA_cat" amino acids 52 to 250 (199 residues), 201.4 bits, see alignment E=1.1e-63 PF04952: AstE_AspA_hybrid" amino acids 264 to 337 (74 residues), 73.1 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 100% identical to ASTE_SHEON: Succinylglutamate desuccinylase (astE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K05526, succinylglutamate desuccinylase [EC: 3.5.1.96] (inferred from 100% identity to son:SO_2338)

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEN9 at UniProt or InterPro

Protein Sequence (344 amino acids)

>SO2338 succinylglutamate desuccinylase (NCBI ptt file) (Shewanella oneidensis MR-1)
MLQALLDSKDFLALTLANPQTLGDEFSFTLGEHTRVNVWDTGVIVFEPAQPQGKDVILSC
GVHGNETAPIELCNTLIKQLLQQKIIAKQRTLFLIGNPLAINNGTRIIDENMNRLFSGEH
SNPPGLVNPERLRAKKLETYVDRFFKAAAAGRQRIHYDLHTAMRASKHEKFAIYPYRPGR
AYSAEQIMFLAASGVDTVLFHHEPTTTFSYFSSEQYGADAFTIELGKVYPMGQNDMTRFI
AAQEMFTRLITDKPLQLESFSTDKVNLYQVCRVINKHFDDFEFTFATDVENFRAFPKGFV
LAREGGQEIKVEQEVESIVFPNAKVPIGNRTVICLIPSVAPDVR