Protein Info for SO2337 in Shewanella oneidensis MR-1

Name: msrA
Annotation: peptide methionine sulfoxide reductase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to MSRA_METTH: Peptide methionine sulfoxide reductase MsrA (msrA) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to son:SO_2337)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEP0 at UniProt or InterPro

Protein Sequence (159 amino acids)

>SO2337 peptide methionine sulfoxide reductase (NCBI ptt file) (Shewanella oneidensis MR-1)
MALATFGAGCFWGVEYFFRQVNGVTNATCGYMGGNNEVTTYEEVKKGKTGHAEVVQVEFD
PTIVSYDELLEVFWKNHNPTTLNMQGGDIGTQYRSTIFFHDREQKAAAEASKLAFARSGR
WGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHLEY