Protein Info for SO2336 in Shewanella oneidensis MR-1

Name: pgm
Annotation: phosphoglucomutase, alpha-D-glucose phosphate-specific (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific" amino acids 1 to 548 (548 residues), 852.8 bits, see alignment E=4.8e-261 PF02878: PGM_PMM_I" amino acids 40 to 183 (144 residues), 95.4 bits, see alignment E=4.8e-31 PF02879: PGM_PMM_II" amino acids 214 to 318 (105 residues), 58.3 bits, see alignment E=1.9e-19 PF02880: PGM_PMM_III" amino acids 325 to 444 (120 residues), 91.5 bits, see alignment E=8.3e-30 PF00408: PGM_PMM_IV" amino acids 486 to 538 (53 residues), 27 bits, see alignment 7.9e-10

Best Hits

Swiss-Prot: 58% identical to PGM_ECOLI: Phosphoglucomutase (pgm) from Escherichia coli (strain K12)

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 100% identity to son:SO_2336)

MetaCyc: 58% identical to phosphoglucomutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEP1 at UniProt or InterPro

Protein Sequence (550 amino acids)

>SO2336 phosphoglucomutase, alpha-D-glucose phosphate-specific (NCBI ptt file) (Shewanella oneidensis MR-1)
MAIHQRAGQIASQMDLVNIPKLMSHYYSIKPNMDAAEQRVTFGTSGHRGTAFQGSFNQDH
IWAITQAVVDYRQSVNIEGPLFLGIDTHALSYAAYVSAIEVLAANKVTVYIQQNDGFTPT
PVVSHAIICANHAAAQNGALLSDGLIITPSHNPPQDGGIKYNPPHGGPAEGNITAWIESR
ANDYLRAALKGVNKLAYADALASGYVHAIDLITPYVADLENVVDMHAIAKANLKLGVDPL
GGSGIHYWAPIAKHYGIDITLVNDKVDPSFSFMSLDKDGKIRMDCSSPYAMAGLLAHKES
FDLCVGNDPDYDRHGIVCPGTGLMDPNHYLAVAIDYLLTHRPEWSDSLAIGKTLVSSALI
DKICVFHGKKLLEVPVGFKWFVDGLAEATIAFGGEESAGAAFLRRDGTTWCTDKDGFILV
LLAAEMLAVTGKTPGQRHQELVAQFGQSFYKRIDSPISLENKAKFAKLNADTLNATMLAG
EKIEAVLTHAPGNNASIGGIKVTTTNGWFAARPSGTEALFKIYGESFISEQHLAEIIKDA
QALIDKALSA