Protein Info for SO2333 in Shewanella oneidensis MR-1

Annotation: hydrolase, alpha/beta fold family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00561: Abhydrolase_1" amino acids 33 to 264 (232 residues), 96.1 bits, see alignment E=8.3e-31 PF12146: Hydrolase_4" amino acids 33 to 126 (94 residues), 33.1 bits, see alignment E=1.2e-11 PF12697: Abhydrolase_6" amino acids 34 to 266 (233 residues), 79.2 bits, see alignment E=2.2e-25 PF00975: Thioesterase" amino acids 37 to 119 (83 residues), 26.6 bits, see alignment E=2.1e-09 PF07819: PGAP1" amino acids 93 to 139 (47 residues), 24.7 bits, see alignment 5.5e-09

Best Hits

Swiss-Prot: 41% identical to YBFF_ECOLI: Esterase YbfF (ybfF) from Escherichia coli (strain K12)

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to son:SO_2333)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEP4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>SO2333 hydrolase, alpha/beta fold family (NCBI ptt file) (Shewanella oneidensis MR-1)
MSNLKHTRHNSHNVRHHSTGNSMNYVSTGQGEAILLIHGLFGNLDNLKGLGQALEAHHQV
IRVDVPNHGLSEHRQQMDYPSLAKAMVDLLDELELERVHIVGHSMGGKIAMATALAYPNR
IISLVAADIAPVAYQPRHNAVFAALESLPLEGHTDRRFALAHLLAAGIDDATAQFLLKNL
QRSGTGFRWKMNLTGLKSGYPNIIGWHNLPNEPQLVFAGPSLFIRGGDSNYVAAAHRDEI
LRQFPQAQAKTLEGCGHWLHAQKPTIFNRIVSEFIDKHTV