Protein Info for SO2309 in Shewanella oneidensis MR-1

Name: crcB
Annotation: crcB protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details PF02537: CRCB" amino acids 5 to 116 (112 residues), 106.8 bits, see alignment E=3.5e-35 TIGR00494: protein CrcB" amino acids 5 to 119 (115 residues), 117.3 bits, see alignment E=2.5e-38

Best Hits

Swiss-Prot: 100% identical to CRCB_SHEON: Putative fluoride ion transporter CrcB (crcB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K06199, CrcB protein (inferred from 97% identity to sbn:Sbal195_2320)

MetaCyc: 44% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EER0 at UniProt or InterPro

Protein Sequence (124 amino acids)

>SO2309 crcB protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNNLLLVALGGSIGAVFRYLISIFMIQVFGSSFPFGTLLVNVLGSFLMGVIYALGQMSHI
SPEFKALIGVGLLGALTTFSTFSNETLLLMQEGDWLKAALNVVLNLSLCLFMVYLGQQLV
FSRI