Protein Info for SO2286 in Shewanella oneidensis MR-1

Annotation: sulfate permease family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 384 to 415 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 24 to 390 (367 residues), 302.6 bits, see alignment E=3.7e-94 PF01740: STAS" amino acids 444 to 537 (94 residues), 47.9 bits, see alignment E=9.9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2286)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EET2 at UniProt or InterPro

Protein Sequence (585 amino acids)

>SO2286 sulfate permease family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKFPSLVSFMPGLALMLQYEKQWLRDDVRAGLSVAAVALPVAIAYAQLTGVNAAVGLYSC
VLPMLVYALFGTSRQLIVGPDAATCAVIAAVVTPLAAGDSMKHWQLVMTMTAMTGFWCLI
ASRFRLGVLADFLSKPILMGLLNGVAITIIVGQFSKIFGFTFDERYLIERLSGAPSYLTK
THWPTLLMGLVTLLTYALVKRYRPQWPASMCAMAVAAFLVWAFNLTSFNINVVGEVSAGL
PSFQAPVFDIGIARELVVPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGIANI
ASALSQGFAVSGADSRTAVNDANGGKSQLVSIIAAVLIALVALFFTAPLKYIPSSALGVV
LVIASISLIDLKALWNLRVRDRSAFLLACTTLFSVLFIGVIPGITLAVLLGLFQFLATVM
RPTDQVLGLDHKGVIRSVDDSGKAKSVPGVFIYRFNSPLTYFNATYFKRRLLEKFIREPD
PVDCIIIDAVPCFTHLDLSVMAMLADLHQLLKKRGIRLVLAGRKRQMLGWFEQAGMQSGE
GGILIRPDLYLALKMNQSYKQALAEGQAPVIKKAPEDDVLLYSHL