Protein Info for SO2277 in Shewanella oneidensis MR-1

Name: ibpA
Annotation: 16 kDa heat shock protein A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF00011: HSP20" amino acids 44 to 138 (95 residues), 67.2 bits, see alignment E=5.9e-23

Best Hits

Swiss-Prot: 61% identical to IBPA_SERP5: Small heat shock protein IbpA (ibpA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 99% identity to spc:Sputcn32_2140)

Predicted SEED Role

"16 kDa heat shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EET9 at UniProt or InterPro

Protein Sequence (147 amino acids)

>SO2277 16 kDa heat shock protein A (NCBI ptt file) (Shewanella oneidensis MR-1)
MRTYDLTPLYRSAIGFDRLAQLAEHAAANNGNSGYPPYNIELLGENRYRITMAVAGFSME
ELEISSEGEKLLVKGNKAESQTERKYLYQGIAERGFERTFQLADYVTVLGASLENGLLNI
DLVREIPEALKPRKIEITTSRLLDSQS