Protein Info for SO2267 in Shewanella oneidensis MR-1

Name: hscB
Annotation: co-chaperone Hsc20 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 13 to 171 (159 residues), 123.6 bits, see alignment E=3.8e-40 PF07743: HSCB_C" amino acids 87 to 165 (79 residues), 57.7 bits, see alignment E=6.3e-20

Best Hits

Swiss-Prot: 100% identical to HSCB_SHEON: Co-chaperone protein HscB homolog (hscB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 100% identity to son:SO_2267)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEU6 at UniProt or InterPro

Protein Sequence (174 amino acids)

>SO2267 co-chaperone Hsc20 (NCBI ptt file) (Shewanella oneidensis MR-1)
MNYFELFKFPPTFDIDTAVLADRYRELQRAVHPDKFANDTEQQRLLSVQRTAQVNDGYQT
LKDPIRRAEHMLSLRGIDLSHETTTVKDTAFLMQQMEWREALEDIRESIDHQAIINELYD
SFAAYRLKLTKLLAAQLSSGSDEDALLAADQVRKLKFMAKLQDELTRIEDALLD