Protein Info for SO2258 in Shewanella oneidensis MR-1

Name: lolD
Annotation: lipoprotein releasing system ATP-binding protein LolD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR02211: lipoprotein releasing system, ATP-binding protein" amino acids 5 to 224 (220 residues), 324.7 bits, see alignment E=1.3e-101 PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 124.7 bits, see alignment E=2.2e-40

Best Hits

Swiss-Prot: 100% identical to LOLD_SHEON: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to son:SO_2258)

MetaCyc: 37% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEV5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>SO2258 lipoprotein releasing system ATP-binding protein LolD (NCBI ptt file) (Shewanella oneidensis MR-1)
MQDVLLQVQAVSKSYHDGDVTTQVLSDVDLQVFKGEQLAIVGTSGSGKSTLLHIMGTLDK
PSSGKVLLAGEDLYQVSSARQAQIRNQDLGFIYQFHHLLPEFTALENVAMPAFIQGRDRT
LAQADAKVLLERVGLGHRMSHIPAELSGGERQRVAIARALINKPKLVLADEPTGNLDAKS
GEAVYELIRELANQLGTAFVVVTHDPKLAARMDRQLTMKNGYLQVPESAQ