Protein Info for SO2248 in Shewanella oneidensis MR-1

Name: sdaA
Annotation: L-serine dehydratase 1 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 56% identical to SDHL_ECOLI: L-serine dehydratase 1 (sdaA) from Escherichia coli (strain K12)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to son:SO_2248)

MetaCyc: 56% identical to L-serine deaminase I (Escherichia coli K-12 substr. MG1655)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
L-serine degradation (3/3 steps found)
glycine degradation (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
D-serine degradation (2/3 steps found)
L-cysteine degradation II (2/3 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
glycine betaine degradation III (4/7 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glycine betaine degradation I (4/8 steps found)
glutathione-mediated detoxification I (3/8 steps found)
purine nucleobases degradation II (anaerobic) (11/24 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEW4 at UniProt or InterPro

Protein Sequence (458 amino acids)

>SO2248 L-serine dehydratase 1 (NCBI ptt file) (Shewanella oneidensis MR-1)
MISVFDMFKIGIGPSSSHTVGPMKAGKIFMQHLADSGQIGQIDELRAELFGSLGQTGKGH
GTGKAVILGLMGEDPETVDTDSIDGILEHVSKSETLTISCGKVVKFTREDGITYHRRKSL
PAHANAMTLYAYSKGECIFERTYYSVGGGFILDEDEINQRNASPASQIESAPYDFNSSAQ
LLELCTEHGLSISSLMMANELSLASEEEVKAKLWNIWQTMKTCIERGYQKEGILPGGLKL
RRRAPALYRRLKAEGRNNVDPLTAMDWVDLFALSVNEQNAAGDRVVTAPTNGAAGIIPAV
LCYYDTFVQEVDIDVCARYLLTAAAIGILYKKNASISGAEVGCQGEVGVACSMAAGALTE
IMGGTVEHVENAAEIGMEHNLGLTCDPVGGLVQVPCIERNAMGAIKAINASRMALRGDGN
HKVSLDKVIKTMMDTGKDMRSKYKETAKGGLAVNIVEC