Protein Info for SO2223 in Shewanella oneidensis MR-1

Annotation: peptidase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07676: PD40" amino acids 85 to 118 (34 residues), 20.6 bits, see alignment (E = 6.9e-08) amino acids 230 to 252 (23 residues), 11.6 bits, see alignment (E = 4.8e-05) amino acids 284 to 300 (17 residues), 13.2 bits, see alignment (E = 1.5e-05) PF00326: Peptidase_S9" amino acids 480 to 686 (207 residues), 216.5 bits, see alignment E=6.4e-68 PF20434: BD-FAE" amino acids 566 to 638 (73 residues), 37.8 bits, see alignment E=3.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2223)

Predicted SEED Role

"Alanyl dipeptidyl peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEY6 at UniProt or InterPro

Protein Sequence (687 amino acids)

>SO2223 peptidase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MDITMKIAPLLLALGAAGLACCAHAADPKPFTVQQLVKLNKLHSAVVSHDGTKLVYGLKT
VNDKGEASSDLYLLDLTQADAKPLQLTSAAGTEHDISFANDDKSIYFLASRSGSSQLFQL
PLTGGEAQQVSDLPLDIDGYKLSNDGKQIVLSMRVFPECKDLACSKDKFKAEEERKSTGR
EYKQLMVRHWDTWEDHARNHLFVGTLNGEKLTKVVDITQGLDTETPPKPFSGMEEVTFTP
DGQYVVYSAKAPSKDQAWTTNYDLWQVSVNGGKATNLTADNIAWDAQPTFSSDGRYMAYL
AMTKPGFEADRYRIMLRDTSTGQSKEVAPLWDRSPSSLMFAPDNRTLYVTAQDIGQVSIF
KVNTQFGDVQSVYSDGSNSLIAIADDQLIFDSKTLVEPGDLYRINTDGQGLKRLTEVNKD
KLAEIKFGEFQQFSFKGWNNEDVYGYWIKPANYQEGKKYPIAYLVHGGPQGSFGNGFSGR
WNAQLWAGAGYGVVMVDFHGSTGYGQAFTDSISQDWGGKPLEDLQKGLAAVSQQQKWLDP
QNACALGGSYGGYMMNWIQGNWNDGFKCLVNHAGLFDMRSMYYVTEEVWFPEHEFGGTYQ
DNKALYEKFNPVNYVENWKTPMLVIHGEKDFRVPYGQGLAAFSFMQRKGIPSELLIYPDE
NHWILKPENLEQWYANVFRWMDSWTKK