Protein Info for SO2217 in Shewanella oneidensis MR-1

Name: ddlA
Annotation: D-alanine--D-alanine ligase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01205: D-alanine--D-alanine ligase" amino acids 6 to 329 (324 residues), 284.3 bits, see alignment E=5.2e-89 PF01820: Dala_Dala_lig_N" amino acids 6 to 109 (104 residues), 59.6 bits, see alignment E=4.6e-20 PF07478: Dala_Dala_lig_C" amino acids 128 to 328 (201 residues), 167.5 bits, see alignment E=2.9e-53

Best Hits

Swiss-Prot: 100% identical to DDL_SHEON: D-alanine--D-alanine ligase (ddl) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to son:SO_2217)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEZ2 at UniProt or InterPro

Protein Sequence (336 amino acids)

>SO2217 D-alanine--D-alanine ligase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKINLLLLCGGGSAEHDISLLSANYFETSLAKSEQFNVLRVVLDKFGQYQTAAGDDCEL
TNNREIRFRDESKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALEKWGSIFVKAASQGSSVGCYKVDEA
SKVLGVLKDAFGYAPYVIVEKTIKARELEVAVYEYQGEVIATLPGEIICDSNTFYTFDEK
YAKSSKARTDVVAQNVPTDISDQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTQYLSLVINSQLAAK