Protein Info for SO2200 in Shewanella oneidensis MR-1

Annotation: ribosomal protein S6 modification protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF18030: Rimk_N" amino acids 15 to 101 (87 residues), 62.3 bits, see alignment E=6.7e-21 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 18 to 294 (277 residues), 229.8 bits, see alignment E=2e-72 PF08443: RimK" amino acids 105 to 294 (190 residues), 156.7 bits, see alignment E=8.4e-50 PF02955: GSH-S_ATP" amino acids 121 to 257 (137 residues), 49.5 bits, see alignment E=5.4e-17

Best Hits

KEGG orthology group: K14940, gamma-F420-2:alpha-L-glutamate ligase [EC: 6.3.2.32] (inferred from 100% identity to son:SO_2200)

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF05 at UniProt or InterPro

Protein Sequence (330 amino acids)

>SO2200 ribosomal protein S6 modification protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MRGWILYKETATQLKPEWYEIERLLAAAKADNIELEVYAPDEFDLTVTREDNKSILLNGQ
PVELPDFIIPRMGSGTTYFALAIIRHLERLGVYCLNPSKAIEIVKDKLFSQQLLAEKNLP
TPKTMLVKFPVDIDLVERHLGFPVVIKTLSGSQGSGVFLSHKAREFDDLMQLIEATNKNA
NIILQEFIANSHGRDLRVFTIGGRVAGCYERRGQEDSFKANVSAGGSARPFDITPEIEWL
ATQTANILDLDVAGIDLLFDNGHYKICEANSSPGFEGLESCLNVDIAAQILHFIRIRLGM
FNKDEKNSDPQLTHAGPALANNVTSSKAAE