Protein Info for SO2194 in Shewanella oneidensis MR-1

Annotation: OmpA family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03789: proteobacterial sortase system peptidoglycan-associated protein" amino acids 3 to 256 (254 residues), 343.3 bits, see alignment E=4.2e-107 PF20721: C19orf12" amino acids 52 to 156 (105 residues), 30.1 bits, see alignment E=3.9e-11 PF00691: OmpA" amino acids 156 to 241 (86 residues), 47.7 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2194)

Predicted SEED Role

"Outer membrane protein and related peptidoglycan-associated (Lipo) proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF11 at UniProt or InterPro

Protein Sequence (269 amino acids)

>SO2194 OmpA family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MMKKTLISVLVFSVFTASIATVSARVSLQNQPLLIEPQTEWTIEQEEDDGEALIGLGGGA
LLGALVGGPVGAVVGGITGTLIGQSVADTELVSVTLKNPQQHIAVQRQQVTSLTVKQLAS
EQRAAEYASTQKHLDALLAEQQQLLSELALGMNVQFRTGSSELEADFLPQLDNVATVMKR
SSESNLELKGYAERRGDWRDNQSLSEHRLLEVRDYLIQQGVAPARMTTQALGAAMSLNEQ
LDSESDVSDRRVTLTIPPTQGLMASRVTE