Protein Info for SO2143 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 445 to 469 (25 residues), see Phobius details amino acids 476 to 499 (24 residues), see Phobius details amino acids 507 to 526 (20 residues), see Phobius details amino acids 538 to 561 (24 residues), see Phobius details TIGR03802: aspartate-alanine antiporter" amino acids 2 to 560 (559 residues), 642.6 bits, see alignment E=6e-197 PF06826: Asp-Al_Ex" amino acids 16 to 181 (166 residues), 140 bits, see alignment E=6.6e-45 amino acids 390 to 557 (168 residues), 166.8 bits, see alignment E=4e-53 TIGR01625: AspT/YidE/YbjL antiporter duplication domain" amino acids 394 to 544 (151 residues), 94.2 bits, see alignment E=6.7e-31

Best Hits

Swiss-Prot: 100% identical to Y2143_SHEON: Uncharacterized transporter SO_2143 (SO_2143) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07085, putative transport protein (inferred from 100% identity to son:SO_2143)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF50 at UniProt or InterPro

Protein Sequence (562 amino acids)

>SO2143 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNWLKTTLQIYPEIAVFLSLAIGYWVGNKTFKGFSLGAVTATLLAAVVIGQFDITLSSNV
KSIFFLMFLFAVGYGIGPQFVQGIAKDGLPQALFAVVACLFSLLFPILCAKIAGYDLGAT
AGFFAGTQTISASMGLATDAIVHLDLPAEESKKMFSVIPVAYAVTYIFGTVGSAIVLAQI
IPKLLRIDLEAACKDYMAKNGGTTENARGEWHTYALRSYKLTEKNRAVGMTIHEFEAQFP
HRKVFVEGLRHEGKVIDTDPNSKLSTGDIIAVGGEYDAFVEFFDHPDSFDETQDSELLNQ
PVLGVDVYVTSRGINGKTLAELGKTTSSHGIFLRKIKRGPKAIEIPILPQTRLFRGDILT
LSGLTKDVERVTKQLGVIDQRGNSMDVAFWAFAIVIGALLGSLVFKIGNLPLTLSTAGGV
LIAGLIFSWVRSFHPTFGWVPEPTVWFMNSVGLNVFIAAIGISAGPNFVAGLKELGFSLF
LWGVVATTLPLFFAALVGKYVFKFHPAILLGCCAGARTTTASLGMINEKAKSNIPSLGYT
ITYAVGNTLLTMWGLVLILILT