Protein Info for SO2137 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein TIGR00427 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 2 to 201 (200 residues), 211.7 bits, see alignment E=4.4e-67 PF01914: MarC" amino acids 4 to 205 (202 residues), 202.6 bits, see alignment E=2.4e-64

Best Hits

Swiss-Prot: 53% identical to YCHE_ECOLI: UPF0056 membrane protein YhcE (ychE) from Escherichia coli (strain K12)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 97% identity to sbp:Sbal223_2370)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF54 at UniProt or InterPro

Protein Sequence (210 amino acids)

>SO2137 conserved hypothetical protein TIGR00427 (NCBI ptt file) (Shewanella oneidensis MR-1)
MELTLYVKFFLGLVAIINPIGLLPVFVSLTSHQTEAERNHTGKVANFAVVVILLVTIVAG
QHILNMFSISLSAFRIAGGTLIAIIAMSMLQGKLGEVKRNQEEDRESSAMESVAVVPLAL
PLMAGPGAISSVIVFAAEHNSLSNFIAMFITVIIFGLVSFGLFRMASIIYKILGKTGINV
ITRLMGLLMLSIGIEVIAAGIKGLFPQLFS