Protein Info for SO2125 in Shewanella oneidensis MR-1

Name: cheD-1
Annotation: chemotaxis protein CheD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 43 to 60 (18 residues), see Phobius details PF03975: CheD" amino acids 70 to 174 (105 residues), 110.3 bits, see alignment E=2.8e-36

Best Hits

Swiss-Prot: 100% identical to CHED1_SHEON: Probable chemoreceptor glutamine deamidase CheD 1 (cheD1) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 100% identity to son:SO_2125)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.44

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF62 at UniProt or InterPro

Protein Sequence (208 amino acids)

>SO2125 chemotaxis protein CheD (NCBI ptt file) (Shewanella oneidensis MR-1)
MLVVKPSLEFALNEPNRYYDRHFERSAVKILPGEYFATRENTMIVTVLGSCVAVCLYDPV
LKIGGMNHFLLPNDNVTAPNMMTESARYGVFAMELLINHVLKLGARRNALEAKVFGGGNV
LRGLTVQNIGERNAEFVLDYLQMEQIPVIAADLLDIYPRKVYFFPETGLVKVRKIKTIHN
STIMDRESEYRLRIKNLPSGGDVELFGE