Protein Info for SO2124 in Shewanella oneidensis MR-1

Name: cheR-1
Annotation: chemotaxis protein methyltransferase CheR (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF03705: CheR_N" amino acids 11 to 59 (49 residues), 49.2 bits, see alignment 3.5e-17 PF01739: CheR" amino acids 75 to 262 (188 residues), 176.6 bits, see alignment E=4e-56

Best Hits

Swiss-Prot: 53% identical to CHER2_PSEAE: Chemotaxis protein methyltransferase 2 (cheR2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to son:SO_2124)

MetaCyc: 46% identical to chemotaxis protein methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-glutamate O-methyltransferase. [EC: 2.1.1.80]; 2.1.1.- [EC: 2.1.1.80]

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF63 at UniProt or InterPro

Protein Sequence (277 amino acids)

>SO2124 chemotaxis protein methyltransferase CheR (NCBI ptt file) (Shewanella oneidensis MR-1)
MEREFNYTPAHFNHARTILYRLAGIKLADSKDALVYSRLVRRIRQLKLAGFSEYFTYLAE
CESEHQEFINALTTNQTAFFREHHHFDILKQYLQTHPQTRRIWCAASSTGEEPYSIAMSV
AEHFGTFQTPIEIIASDIDSVVLSKAEKGIYPIDRLSAVSDIRKKRFFHRGIGAQQGNVR
VIPELRQMLQFTRINLLDESWPISTPIDVIFCRNVMIYFDRVTQEVILKHMMSTLTPTGL
YIAGHSENFAMFPDIVTACGRTTYKPTKRNASGKTKS