Protein Info for SO2116 in Shewanella oneidensis MR-1

Annotation: acetyltransferase, GNAT family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 903 PF02629: CoA_binding" amino acids 11 to 103 (93 residues), 37.4 bits, see alignment E=1.1e-12 PF13380: CoA_binding_2" amino acids 14 to 140 (127 residues), 78.6 bits, see alignment E=1.6e-25 PF13607: Succ_CoA_lig" amino acids 157 to 292 (136 residues), 175.4 bits, see alignment E=1.6e-55 PF13549: ATP-grasp_5" amino acids 487 to 708 (222 residues), 254.4 bits, see alignment E=2.5e-79 PF13302: Acetyltransf_3" amino acids 740 to 879 (140 residues), 28.7 bits, see alignment E=5.9e-10 PF00583: Acetyltransf_1" amino acids 788 to 878 (91 residues), 27.9 bits, see alignment E=7.7e-10

Best Hits

Swiss-Prot: 52% identical to LYSAC_SALTY: Peptidyl-lysine N-acetyltransferase Pat (pat) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K09181, hypothetical protein (inferred from 100% identity to son:SO_2116)

MetaCyc: 52% identical to peptidyl-lysine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF70 at UniProt or InterPro

Protein Sequence (903 amino acids)

>SO2116 acetyltransferase, GNAT family (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQRTLHSLFKPTSVAIIGASNSEKRAGNVLMKNLLSSGFSGPIMPVTPKYRAVMGVLAY
PNIEALPIKPDLAVICTRASRVPAIVETLAQFGCKVAIIMASGMAQEVNDDGVSLLDLAM
QHAKRYGMRILGPNSLGILLPPLGLNASLAHASALSGKIAFVSQSAAICTTVLDWANNKG
IGFSSFISLGDGTDINFDELLDYLGRDSRTSAIMLYIDSVNEKRHFLSAARAASRNKPIL
VIKSGRSAEGVRAAKQHTGGIGGNDAVYEAAFRRAGMLRVNDLIELFAAVESLAHSNPLQ
GERLGIISNGGGPAVLAVDELILRGGKLAELSQETLAKLNVVLPTTWSKQNPVDIIGDAD
ASRYANALNILMDSEELDAILVLHSPSALGESVEIADALVKVIHAHPKKNRLNILTNWSG
EDSAYQARKRFTKGGISTYRTPEGAVGAFMHMVEYRRNQKLLQEVPQSIPDNIPTDSQTA
RKLLQAAQAKGKAVLETHEASPILRAYGLNTIDTWFVKDADEAVAIANEAGYPLALKVQS
PNILHKSDVHGVMLNLTSMEDIRHAANAITQRVHQANPDAIIEGMIVQKMALTAGAQEIR
VAVINDPVFGPAICLGEGGSEWDPTRDAAVALPPLNMALARYMVIQALKTHKLKDRHLPL
GLDMNALCVMLTQISHIIIDCPEIASLDLNPVLAAGENITLLDVNIRLHDANTDNPSRLA
IMPYPKELEEFAELKNGLKVMLRPILPEDEPKHLAFDNSLSDEDRYKRYFGVRSKMTHEE
MAVLTQIDYAREMAFIATAKGPDGDDITLGAVRASIDPDNTEAEFAMAVRGDHQGIGLGK
LLLEKLIKYYQANDTPVLTGFTMFENRNMASLAKNLGFKVTFDMEEHLIKMHMDLKSNNP
VSS