Protein Info for SO2112 in Shewanella oneidensis MR-1

Name: rplY
Annotation: ribosomal protein L25 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF01386: Ribosomal_L25p" amino acids 58 to 145 (88 residues), 85.3 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 100% identity to son:SO_2112)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>SO2112 ribosomal protein L25 (NCBI ptt file) (Shewanella oneidensis MR-1)
MFIDNDNPLVPYLFRVVSFLCLLGNCVSMRALYMSHHWSKMVTFFTLNLSEKHMSYTITA
QTRTEIGKGSSRRLRHAGKVPAVIYGAGKEPVSIVFDHKDIINAQANDDFYTSVVTIVLD
GKEVGVRAQAMQRHAFKPIIEHVDFVYA