Protein Info for SO2108 in Shewanella oneidensis MR-1

Name: mdoH
Annotation: periplasmic glucans biosynthesis protein MdoH (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 transmembrane" amino acids 58 to 83 (26 residues), see Phobius details amino acids 90 to 117 (28 residues), see Phobius details amino acids 408 to 431 (24 residues), see Phobius details amino acids 460 to 480 (21 residues), see Phobius details amino acids 500 to 526 (27 residues), see Phobius details amino acids 553 to 589 (37 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 136 to 316 (181 residues), 33.6 bits, see alignment E=5.5e-12 PF13506: Glyco_transf_21" amino acids 200 to 426 (227 residues), 35.4 bits, see alignment E=8.7e-13 PF13632: Glyco_trans_2_3" amino acids 232 to 425 (194 residues), 50.8 bits, see alignment E=2.8e-17

Best Hits

Swiss-Prot: 100% identical to OPGH_SHEON: Glucans biosynthesis glucosyltransferase H (opgH) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to son:SO_2108)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF78 at UniProt or InterPro

Protein Sequence (727 amino acids)

>SO2108 periplasmic glucans biosynthesis protein MdoH (NCBI ptt file) (Shewanella oneidensis MR-1)
MTVSESSVLDTEVLVGGSAMPNERPGPMEPQSLSQMPEGFPRRSTVANGVRSRASRRFFV
VGGALLLSSFAIYEMGAVFSIGGITPLEYLMLALFAINFCWIALAFCSGIAGFLLLLKKP
KPNELAQTELHTRTAILMPTYNESPDRVFSAVSVMAEALSQTGHGHAFDWFILSDTTDPE
IALLEEQAFLVLRQETHKHSRVYYRRRRKNVARKAGNVADFCRRWGSRYDHLLVLDADSL
MESSTITGLAQRMQADPDAGLIQTIPSLINGTTLMARLQQFAARIYGPVIGTGLGWWVQK
EGNFWGHNAIIRTEAFMGAAGLPNLKGKPPFGGHILSHDFVEAALIRRAGWSVVIAYDLP
GSYEECPPSIVDLAVRDRRWCQGNLQHSRILPTKGLHWVSRLHLMTGIMAYLSSPFWLLL
ILTGLMLALQAHFIRPEYFTDQFSLFPTWPIMDSDRALRLFYITMVVLFGPKIFGVLLLL
KDGKFARSVGGRIKAMFSVLFEVILSALIAPIMMFIHCGAVMSILMGRDSGWSPQRRDDG
SMPWLTLIYRHRWHMLAGVMLGYAAILDSLTLLAWMSPALIGLWLAVPISAWTGSIKIGE
FFKRIGILATPEERNPAPICIRAQEARAAYQSHIEQPWTLAQLLKDPALMELHLAMVDKQ
PLRAAGTPIEPVEAIVHVKVHEAQCQQSALALFNRQEMALVLANPLMLRSLQKLPEQFVP
EDLVSFC