Protein Info for SO2105 in Shewanella oneidensis MR-1

Annotation: sensor protein YgiY, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details PF08521: 2CSK_N" amino acids 39 to 185 (147 residues), 25.5 bits, see alignment E=1.8e-09 PF00512: HisKA" amino acids 262 to 326 (65 residues), 43.8 bits, see alignment E=3.3e-15 PF02518: HATPase_c" amino acids 377 to 475 (99 residues), 67.8 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 100% identity to son:SO_2105)

Predicted SEED Role

"Signal transduction histidine kinase for Quinone-reactive Ni/Fe-hydrogenase" in subsystem Hydrogenases

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF81 at UniProt or InterPro

Protein Sequence (476 amino acids)

>SO2105 sensor protein YgiY, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MFTLTINNGDNRVNRLKVLDVYSLRLLLTLLMLSGISLSVGISSWLSTRDAKHQIEELFD
AQMLQTAKMLELFYHDEADFKHPQSQPQVLHVPDSQVSSFAEKSDALKLAYEHKLAFQIW
SEAGQALVFSDNIGREPLTKFEQGYSKRVFEGELWHVFSFLSAKYKVWIITAQQDEVRQE
LVSQIMHNAVIVPLIVVPLTLLIVSLLFYILFRPLKTFERELMARSPNDLTPLAMSLPKE
LVPVRLALNQYISSIARFIARERRFSADAAHELKTPLSVIKLHQQGLEGLVGDDPAQHIH
LAAIDAGVKHMSHTVEQLLLLARVDSIAELNVQSYALLPMVEDALNQLMPLITEYEWNID
VDAGLILKCDRFYWLVVLKNIIENACKYSPIETEISISAVQVAAGVEIKIADRGQGMTSE
QIANATERFYRVNENEGIGAGLGLSICHHIIGLHQGQLTIASREQAGLAVTLFLPQ