Protein Info for SO2097 in Shewanella oneidensis MR-1

Name: hydC
Annotation: quinone-reactive Ni/Fe hydrogenase, cytochrome b subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details TIGR02125: Ni/Fe-hydrogenase, b-type cytochrome subunit" amino acids 12 to 219 (208 residues), 271.5 bits, see alignment E=2.1e-85 PF01292: Ni_hydr_CYTB" amino acids 13 to 214 (202 residues), 89.3 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 43% identical to CYBH_WOLSU: Quinone-reactive Ni/Fe-hydrogenase B-type cytochrome subunit (hydC) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K03620, Ni/Fe-hydrogenase 1 B-type cytochrome subunit (inferred from 100% identity to son:SO_2097)

Predicted SEED Role

"Quinone-reactive Ni/Fe hydrogenase, cytochrome b subunit" in subsystem Hydrogenases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF88 at UniProt or InterPro

Protein Sequence (224 amino acids)

>SO2097 quinone-reactive Ni/Fe hydrogenase, cytochrome b subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MNHSETRIRTLVFSPAIRIFHWLRALTILVLVITGFYIAWPFLVAPESTDVLVQGWIRFA
HLICGFILTAVTLARFYLYFFSRSNIERRSFRDVMSIKSWITQLKSYIWMGHLHKAGVYG
PLQFVTYVAISFVALVICITGLVLYANVYHEGLGGMLWSSAAWITAQMGGLAQVRIWHHY
LTWAFVIFVVIHVYMAVWSGIRFKHNSVDSIVSGYDYPKPDSHH