Protein Info for SO2096 in Shewanella oneidensis MR-1

Annotation: hydrogenase expression/formation protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR00072: hydrogenase maturation protease" amino acids 4 to 151 (148 residues), 124.9 bits, see alignment E=1.3e-40 PF01750: HycI" amino acids 20 to 150 (131 residues), 97.8 bits, see alignment E=2.3e-32

Best Hits

Swiss-Prot: 51% identical to HYDD_WOLSU: Protein HydD (hydD) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K03605, hydrogenase 1 maturation protease [EC: 3.4.24.-] (inferred from 100% identity to son:SO_2096)

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF89 at UniProt or InterPro

Protein Sequence (192 amino acids)

>SO2096 hydrogenase expression/formation protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKILLLGIGNVLYADEGIGVHFVNYITENYQFTHESHQLEMLDGGTLAQGLIPIICQYDY
LIVVDTVNANGVDAGEVYFFDFDKAPQEIDWQGSAHEVEMLQTLNMMEMVGDRPKTFVLG
VTPTVLEPMTLGLTSKVASAVPLMERTLLSHLAALGFTATRIAEHSIDSLIPDSYKRGVN
LGENREDEKHQI