Protein Info for SO2094 in Shewanella oneidensis MR-1

Name: hypF
Annotation: hydrogenase maturation protein HypF (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 808 PF00708: Acylphosphatase" amino acids 6 to 89 (84 residues), 77 bits, see alignment E=2.8e-25 TIGR00143: carbamoyltransferase HypF" amino acids 8 to 795 (788 residues), 705.4 bits, see alignment E=4.2e-216 PF07503: zf-HYPF" amino acids 116 to 149 (34 residues), 56.3 bits, see alignment (E = 5.4e-19) amino acids 166 to 198 (33 residues), 60.9 bits, see alignment (E = 2e-20) PF01300: Sua5_yciO_yrdC" amino acids 228 to 394 (167 residues), 168.7 bits, see alignment E=2.3e-53 PF17788: HypF_C" amino acids 424 to 530 (107 residues), 104.8 bits, see alignment E=8.3e-34 PF22521: HypF_C_2" amino acids 540 to 794 (255 residues), 197.5 bits, see alignment E=7.8e-62

Best Hits

KEGG orthology group: K04656, hydrogenase maturation protein HypF (inferred from 100% identity to son:SO_2094)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF91 at UniProt or InterPro

Protein Sequence (808 amino acids)

>SO2094 hydrogenase maturation protein HypF (NCBI ptt file) (Shewanella oneidensis MR-1)
MIERRQLHITGIVQGVGFRPFVYRWATELQLTGTVLNNAKGVMIELQGPSARLDIFIQEL
ATNPPPLARIDHISHGQLAIKLAETHFEIVQSDSQSDGTKDRSLAALVAVSADKSTCQDC
LDDMHNPQDRHFGYAFTNCTNCGPRYSIINALPYDRHHTAMADFAMCPDCAKAYQDPLNR
RYHAQPVSCPKCGPQLSLKTPKGELIALTPSLNSQDNSMAVLSAAANMLAQGHILAIKGL
GGFHLMCDARNSHAVSQLRQRKQRKAKPLAVMMPSIEMAKQYVTGTEAEWQTLSSPERPI
VLMQALDEHDLNPEIAPNIPKLGVFLPYTPLHHLLLSQFNGPLVATSANVSGEPIITDCD
ALISQLGHVVDAIVDHNRPILNGCDDSVVQLIQQPNGSTPQVQVLRLARGYAPLSFPLTA
PLTRSILAVGAQQKNAIAFGFGANVFLSPHIGDLFSVSAEQYFERTLATFARLYHFSPEL
IVHDKHPDYAPSRWAEAQQQKSPDTQSGTSGSIQTLSVQHHHAHVLSVMAINQYQEPVLG
FSFDGTGLGDDGSLWGGEVLLTRLDKAERLAHFEAISLLGGEQAIKQPVRLLLALLFEQM
SLAAVQALDLPILKSLTPITLSNLHRIWQNGHTIKSSSVGRLFDALACALGLIDTTQFEG
QAGMLIEAAARRADKQHLPSLILDLPLCSSEDDPRQVQVWCSSQLFKQLIVHITEAPLSS
HRQSIIARAFLHSLGDAICSYAARYPSLPIALCGGVFQNQYLLEYCLSKLHLQGNIVLPN
KHIPVNDGGIALGQLWYGIHQEANAELS