Protein Info for SO2074 in Shewanella oneidensis MR-1

Name: hisG
Annotation: ATP phosphoribosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR00070: ATP phosphoribosyltransferase" amino acids 32 to 222 (191 residues), 182.8 bits, see alignment E=5.9e-58 PF01634: HisG" amino acids 79 to 243 (165 residues), 162.9 bits, see alignment E=6e-52 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 226 to 323 (98 residues), 96.4 bits, see alignment E=9.6e-32 PF08029: HisG_C" amino acids 248 to 321 (74 residues), 80.4 bits, see alignment E=8.8e-27

Best Hits

Swiss-Prot: 100% identical to HIS1_SHEON: ATP phosphoribosyltransferase (hisG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to son:SO_2074)

MetaCyc: 68% identical to ATP phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
ATP phosphoribosyltransferase. [EC: 2.4.2.17]

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFB0 at UniProt or InterPro

Protein Sequence (324 amino acids)

>SO2074 ATP phosphoribosyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MPISQLKRETKEYHFEFVNFERDRIMTESNRLRIAIQKSGRLSTDSQQLLKSCGVKFSIN
EQRLIAHADNMPIDLLRVRDDDIPGLVMDGVVDLGIIGENVLEEEQIERQTLNKPAEYVK
LRQLDFGACRLSLAVPTEFSYADASSLEGLRIATSYPNLLRRFMQQKSINYRDCMLKGSV
EVAPRAGLADGICDLVSTGATLEANGLYETEVIYRSMACIIQSTQTQAPSKQALIDRILS
RVNGVIRARESKYILLHAPTETLDQIVALLPGAENPTVLPLNDDTNRVAIHAVSTEDLFW
DTMEQLTALGASSILVMPIEKMMG