Protein Info for SO2070 in Shewanella oneidensis MR-1

Name: hisH
Annotation: amidotransferase HisH (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  • amino acids 10 to 220 (211 residues), 202.6 bits, E=2.8e-64
• PF00117: GATase
  • amino acids 12 to 218 (207 residues), 66.3 bits, E=3e-22

Best Hits

Swiss-Prot: 100% identical to HIS5_SHEON: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to son:SO_2070)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

See Q8EFB4 at UniProt or InterPro

Protein Sequence (221 amino acids)

>SO2070 amidotransferase HisH (NCBI ptt file) (Shewanella oneidensis MR-1)
MSANTDEFDVVIIDTGCANLSSVRFAFERLGANVLVTDDKASIKAAKRVVLPGVGSAGAA
MASLTEKALVELIQGLTQPVLGVCLGMQMLTLLSKERGGQALDCQAHDCKCLGIIPTEID
ELNSQTLKAEGLPLPHMGWNQLTFSNPSQVHPLFAGVEAGSYVYFVHSYRAPLSDYTLAQ
CRYGEDFSAAIGKDNFMGVQFHPEKSAAVGAQILGNFLKMQ