Protein Info for SO2062 in Shewanella oneidensis MR-1
Annotation: conserved hypothetical protein (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to YDBL_ECOLI: Uncharacterized protein YdbL (ydbL) from Escherichia coli (strain K12)
KEGG orthology group: K09978, hypothetical protein (inferred from 100% identity to son:SO_2062)Predicted SEED Role
"Putative uncharacterized protein ydbL, may be related to amine metabolism"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EFC1 at UniProt or InterPro
Protein Sequence (116 amino acids)
>SO2062 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1) MKLVPLKTLRLKPKLLLLLSLGLFSLNVFAMSLQEAKSQGYLGEQPNGYLGLVQNNSDAK AVMDEVNNKRRAHYETIAKKNNLSAADVAKLAGEKAIAATDKGNYVQNAQGKWVKK