Protein Info for SO2048 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details PF08019: EptA_B_N" amino acids 55 to 204 (150 residues), 158 bits, see alignment E=1.7e-50 PF00884: Sulfatase" amino acids 234 to 524 (291 residues), 213.5 bits, see alignment E=4.5e-67

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to son:SO_2048)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFD3 at UniProt or InterPro

Protein Sequence (541 amino acids)

>SO2048 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLTRFKTLSVNRFTFIIALFYVCVFNIPLFEIIKKGIEKQPDVDPIFIATMPLFLLFALS
FVFSLFTVKYLLKPFFIVLTLLSSSVFFAALKYNVVFDYGMIENTFQTNSAEALMYVNFA
SILNMLLTGLLPAYLIYKADIQYQPFFKELLRKILFMLAMLAGVGIIAFFYFQDYAAFGR
NNDEIKRYIVPTYFIGAAAKYLNVHYLQTPIEYEQLGLDAKNVSPNANGKPNLLVLVVGE
TARSMNYQYYGYDKPTNAHTQGQGLLAFKETHSCGTATAVSLPCMFSRMGREDYDSRRAY
AQDTVIDVLNHGGIKVQWFDNDSGCKGVCDQVENITIDLNSDPALCSGQYCFDQVLLNKL
DEALAKAEQKDTVIALHIIGSHGPTYYLRYPPEHRKFTPDCPRSDIQNCSTEELMNTYDN
TILYTDYIISEVVNKLKQQQEKFDTAMFYLSDHGESLGEKGMYLHGAPYSIAPIEQTSIP
MLAWFSEDFSQDNQLNMACLAKEAEKGGFSHDNLFDSLLGLMNVQTQVYQAELDIFARCR
G