Protein Info for SO2045 in Shewanella oneidensis MR-1

Annotation: cation efflux family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 37 to 187 (151 residues), 117.6 bits, see alignment E=3.2e-38 amino acids 240 to 385 (146 residues), 89 bits, see alignment E=1.7e-29 PF01545: Cation_efflux" amino acids 43 to 310 (268 residues), 104.9 bits, see alignment E=2.4e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2045)

Predicted SEED Role

"Cation efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFD6 at UniProt or InterPro

Protein Sequence (394 amino acids)

>SO2045 cation efflux family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKITPSTETAQPSNGFGHSIAQWQHPHGFSKQNADGEKNTRYVLYLTVITMVAEIVAGTI
YGSMALLADGWHMGTHAAAFMITLFAYSYARKHANDPAFAFGTGKVSVLGGYTSAIALGL
VALIMLIESGMRLINPENIHFNEAIFVALIGLSVNVLSMFLLKDHHSHDHGHSHGNSHGH
SLHQVHDKHEHTAHKDNHCCDGLEHHAADHDHDHDHDHDHDHDHDHDHDNHSHNHAHGHS
HGHSGHDHNLRAAYFHVLADALTSVLAIAALLFGKYMGLTWLDPIMGIVGAIIISRWSWG
LIQQTSPILLDGGVNVALQRKVRETIEAVPDHQVADLHIWRVSADHHAIMASIVSHSPKE
ASYFNQLLSQFPELSHITIELHTCRQGECVAKEA