Protein Info for SO1986 in Shewanella oneidensis MR-1

Annotation: RNA polymerase sigma-70 factor, ECF subfamily (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF07638: Sigma70_ECF" amino acids 45 to 214 (170 residues), 27.5 bits, see alignment E=5.7e-10 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 59 to 216 (158 residues), 82.6 bits, see alignment E=1.3e-27 PF04542: Sigma70_r2" amino acids 63 to 130 (68 residues), 53.5 bits, see alignment E=3.3e-18 PF08281: Sigma70_r4_2" amino acids 163 to 213 (51 residues), 35 bits, see alignment E=1.8e-12 PF04545: Sigma70_r4" amino acids 167 to 214 (48 residues), 43.3 bits, see alignment 4.3e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to son:SO_1986)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFI6 at UniProt or InterPro

Protein Sequence (222 amino acids)

>SO1986 RNA polymerase sigma-70 factor, ECF subfamily (NCBI ptt file) (Shewanella oneidensis MR-1)
MENFQSHLAQNRYDRQLSPPIEMAMENDNHNLTADEHITDIDPLVSAIIKVANQRDKAAF
GYLFSHFMPKIRAFGLQRLNQQGLAMDLVQETMTTVWTKSHLYNADKGSVATWVFTIMRN
QCFDMLRRVQHNREDAFGDDIWPLYDVAVNQDNNPDHKLTAKLLAHLDALPLAQRQVVQG
IYMQELTQQELADALKVPIGTIKSRLRLGLEKLKSFLETQHD