Protein Info for SO1980 in Shewanella oneidensis MR-1

Annotation: phosphoribosyl transferase domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR01251: ribose-phosphate diphosphokinase" amino acids 70 to 281 (212 residues), 130.5 bits, see alignment E=3.2e-42 PF13793: Pribosyltran_N" amino acids 70 to 124 (55 residues), 36.5 bits, see alignment E=4e-13 PF00156: Pribosyltran" amino acids 156 to 276 (121 residues), 40.2 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 100% identity to son:SO_1980)

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFJ2 at UniProt or InterPro

Protein Sequence (301 amino acids)

>SO1980 phosphoribosyl transferase domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQRIQVSQQIQTSQDVSKAQCLQADFYQLPAASDEANYRLFQFGAGENHVQLLVPPAKR
VTLFFGYRGDHSIMQLLLLTDALRRNGAEQIDLLLPYMPGARQDRVCNVGEALSVKVYAS
LINQQQYASVSVFDPHSDVTAALLDRVQVIDNHSFVAAIAAQLTGELVLVSPDAGANKKV
FGLAKALQGMPVIRADKHRDVVNGHIIATEVFCDDLSGKTCLIVDDICAGGRTFIELAIK
LKQKRAQSVILIVSHYEDKASESALREAGIDRLFCTDSLGVPTHISSEFCDCHAVLSYMN
H