Protein Info for SO1979 in Shewanella oneidensis MR-1

Annotation: MutT/nudix family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00293: NUDIX" amino acids 22 to 147 (126 residues), 52.2 bits, see alignment E=6.8e-18 PF21906: NrtR_WHD" amino acids 166 to 222 (57 residues), 70.5 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1979)

Predicted SEED Role

"Nudix-related transcriptional regulator NrtR" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFJ3 at UniProt or InterPro

Protein Sequence (237 amino acids)

>SO1979 MutT/nudix family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTEAEYLANYDPKAFKAQLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDET
CDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIA
SVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVH
EVLLGKPIQGKSFRRRVEQADLLIDTGLKRTERGRPANLYCLKPDTASYRFLRNLEC