Protein Info for SO1948 in Shewanella oneidensis MR-1

Annotation: sodium:dicarboxylate symporter family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 48 to 72 (25 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 268 to 284 (17 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details amino acids 337 to 380 (44 residues), see Phobius details PF00375: SDF" amino acids 11 to 407 (397 residues), 448.6 bits, see alignment E=1e-138

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1948)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFM2 at UniProt or InterPro

Protein Sequence (437 amino acids)

>SO1948 sodium:dicarboxylate symporter family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MATSLQNKLGLTSKILIGMATGIIFGLILRNLFPDSIFIKDYITDGFLHVIGTIFISSLK
MLVVPLVFISLVCGTCSLSEPSKLGRLGGKTLAFYLFTTVLALVLAVFAAVIVHPGDATL
ANEKLNYVAKEAPSFAQVIIDMMPTNPVQAMSEGNMLQIIIFAVIFGFAIAHLGERGNRI
AQLFDDLNNVIMRVVTLVMQLAPYGVFALMAKLALTLGLETFGSVVKYFFLVLTLLLIHN
FVTYSILLKAFSGLNPLIFIRKMRDVQLFAFSTASSNATLPITIEASEHRLGVDNKIASF
TLPLGATINMDGTAIMQGVATVFIAQVFGIELSLTDYAAVIVTATLASIGTAGVPGVGLI
MLAMVLNQVGLPVEGIALIIGVDRLLDMVRTAVNVTGDCVATVIIAKSEGEFNETVFNNT
QAGKIAPSFDEQVHKID