Protein Info for SO1928 in Shewanella oneidensis MR-1

Name: sdhA
Annotation: succinate dehydrogenase, flavoprotein subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 TIGR01816: succinate dehydrogenase, flavoprotein subunit" amino acids 6 to 588 (583 residues), 894 bits, see alignment E=3.5e-273 TIGR01812: succinate dehydrogenase or fumarate reductase, flavoprotein subunit" amino acids 9 to 588 (580 residues), 781.2 bits, see alignment E=5.9e-239 PF00890: FAD_binding_2" amino acids 9 to 405 (397 residues), 410 bits, see alignment E=1.4e-126 PF02910: Succ_DH_flav_C" amino acids 460 to 588 (129 residues), 132.8 bits, see alignment E=7.3e-43

Best Hits

Swiss-Prot: 80% identical to SDHA_ECO57: Succinate dehydrogenase flavoprotein subunit (sdhA) from Escherichia coli O157:H7

KEGG orthology group: K00239, succinate dehydrogenase flavoprotein subunit [EC: 1.3.99.1] (inferred from 100% identity to son:SO_1928)

MetaCyc: 80% identical to succinate:quinone oxidoreductase, FAD binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFP2 at UniProt or InterPro

Protein Sequence (588 amino acids)

>SO1928 succinate dehydrogenase, flavoprotein subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MSIPVREFDAVVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQDAIEFMCQTGPEAIIELEHMGLPFSRFDNGKIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTQVFSEWYALDLVKNQDGAIVGC
TAIEIETGEIVYFKAKATVLATGGAGRIYASTTNAHINTGDGVGMAMRAGVQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHCLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PTKVSGQVIRKNTDGTEQDVVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDETADPKDATDADIQASLARLQRWESNKDGEDPVQIRKDLQLCMQLNFSVFRRGDAM
AEGLEQLKAIRKRLENAKLSDNSREFNTQRIECLELDNLMATAIATAYAANFRTESRGAH
SREDYLERDDENWLCHSLFDPVTETMDRRAVNMAPKLREAFPPKKRTY