Protein Info for SO1923 in Shewanella oneidensis MR-1

Annotation: AcrB/AcrD/AcrF family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1020 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 329 to 348 (20 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details amino acids 460 to 482 (23 residues), see Phobius details amino acids 520 to 540 (21 residues), see Phobius details amino acids 834 to 854 (21 residues), see Phobius details amino acids 861 to 880 (20 residues), see Phobius details amino acids 886 to 908 (23 residues), see Phobius details amino acids 933 to 952 (20 residues), see Phobius details amino acids 964 to 990 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 993 (990 residues), 580.1 bits, see alignment E=8.2e-178 PF02355: SecD_SecF_C" amino acids 835 to 988 (154 residues), 28.5 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 100% identity to son:SO_1923)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFP7 at UniProt or InterPro

Protein Sequence (1020 amino acids)

>SO1923 AcrB/AcrD/AcrF family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNLTRLAIKLPVTTSMFFFAILLFGLASSRLLPLEMFPGIDIPQIVVQVPYKGSTPAEVE
RDITKVLEESLATMGGIDELESESSQEGAEIEINMKWGENVATKSLEAREKIDAVRHLLP
RDVERVFIRQFSTADMPVLTIRISSDRELSGAFDLLDKQLKRPLERVEGVSKVSLYGVEQ
KQIEVRINANRLAASGFSATELQARLARENFVLSAGTLRESNLVYQVSPKGEFRNLEDIK
ALVLVPGLTLGDVADVQFSLPERSEGRHLDQHYAVGLDVFKESGANLVEVSDRVLKVIEQ
AKQDQQFQGIRLFIMEDQASGVKSSLTDLLLSGLVGALLSFIILYLFLRNFKMTMIVVSS
VPISIGMTLAAMYLLGYSLNILSMMGLLLAVGMLIDNAVVVTESVLQEKQGNSVNSNPQD
NENAVMTGVDKVSLAVLAGTLTTAIVFLPNIFGVKVQLTIFLEHVAIAICISLAASLLVA
KTLIPLMLTKFHFDIEPDNTTGKLQNFYNRSLNWVLIRPWRSGLISIAILASTALPISMV
KQDQEDSQSKERIYINYQVEGRHNLNVTEAMVNQMEDYLYKNKEQFHIDTVYSYYAPDDA
SSVILLKKDLPMPLDELKQKIRSGFPKYSIAKPQFGWGDDNSGVRVTLTGRSTSELIHLS
EQVLPLLKNIKGLVDVRSEVNGAQQEVVIRINRQMAARLDLKLNEVASSISMALRGTPLR
SFRHDPSGELRIEMAYEKEWQKSLDKLKQLPVVRIDQRLYTLDNLASIEIQPRFDTIKHY
NRQTSLSIGANLDNLTTEEAQTKIKQVMENVSFPDGYNYSLRGGFERQEEDQSIMVINML
LAIAMIYIVMAALFESLLLPTAIITSILFSITGVFWALLLTGTPMSVMAMIGILILMGVV
VNNGIVLVDQINQMTPELDKLSDTIREVCITRLRPVLMTVGTTVLGLVPLAMDDTQIGGG
GPPYYPMAIAIIGGLSFSTLTSLYLVPLCYQLLYRMRYRAVLQLGESHRFAQKLLPWTAR