Protein Info for SO1881 in Shewanella oneidensis MR-1

Annotation: HlyD family-related protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 341 (305 residues), 230 bits, see alignment E=1.8e-72 PF13533: Biotin_lipoyl_2" amino acids 61 to 108 (48 residues), 24.1 bits, see alignment 3.7e-09 PF16576: HlyD_D23" amino acids 62 to 261 (200 residues), 102.4 bits, see alignment E=3.4e-33 PF13437: HlyD_3" amino acids 159 to 259 (101 residues), 45 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1881)

MetaCyc: 33% identical to vibriobactin efflux pump periplasmic adaptor protein (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-502

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFT5 at UniProt or InterPro

Protein Sequence (360 amino acids)

>SO1881 HlyD family-related protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKIIIIIAILAAAWFGYQAMQPQEQAKVQVKLPPNVVIAAAAMAQVRDEVEAIGTNKAY
ESVTITPKVTDVVTSLKFDDGDIVKKGDLLVQLQNAEQLAKVKVAQVKVSDNQRELARIS
SLVTSRTVAELERDRLQTLIDTTRAELEQAQSSLNDRSIVAPFNGRLGLRQVSVGSLVTP
GTEISTLDDISKIKLDFSVPERFIQELQPGKLVEAKAVAFPDEIFKGKVISIDSRVNPTT
RAVIVRAEIPNHDLRLLPGMLMKVKLIKRSREALMLPESAIIPIQKSHFVYSVNKDNVIE
RKQVTIGIRTRGWVEITDGLAIGENVVIRGLLKVHPGDVVNTQLAEKFSYLSDATAEPSV