Protein Info for SO1851 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 PF22020: RlmL_1st" amino acids 3 to 57 (55 residues), 52.9 bits, see alignment 1.5e-17 PF02926: THUMP" amino acids 67 to 151 (85 residues), 49 bits, see alignment E=3.4e-16 PF01170: UPF0020" amino acids 162 to 371 (210 residues), 180.4 bits, see alignment E=1.7e-56 PF10672: Methyltrans_SAM" amino acids 458 to 664 (207 residues), 86.1 bits, see alignment E=1.2e-27 PF03602: Cons_hypoth95" amino acids 542 to 686 (145 residues), 41.8 bits, see alignment E=4.9e-14 PF13847: Methyltransf_31" amino acids 544 to 665 (122 residues), 30.1 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 100% identical to RLMKL_SHEON: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 100% identity to son:SO_1851)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFW4 at UniProt or InterPro

Protein Sequence (711 amino acids)

>SO1851 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLNFFAAAPKGFEYSLAQELTEFGATEIKESVAGVYFTAPLTLAYRITLWTRLASRIVLV
IYKGPCESAEQLYNAAYCIDWSAHFSNRNTFSIDFHGTGGFINNTQFGALKIKDAIVDRF
RDDGDARPNVARIDADIKVDAHFRNGVITIAMNFSGPSLHQRGYRSTTGEAPLKENLAAN
MLVRSGWKAAPTTLLDPFCGSGTVLIEAALMAADIAPGLQRNRFGFEHWRRHDKATWHEI
VEEAKARASLGVKRCEVKFYGSDIDSRLVALAKRNAQNAGVLELIEFNVANALNVEPPAA
EGYLITNPPYGERLGSVSELLQLYYQLGDKFKKEFGGWKVAMLCSDIELISALKLKADKQ
MKMFNGALECAFNLYTLHAQSTRRDTPVLPEGVDIADIAPAFANRIKKNAKQFEKWAQKE
GIDSYRLYDADIPEYNVAVDKYLDYVVVQEYMAPASIPEAVTKRRLSDVLLALPAAIGVD
PHKIIMKTRERQKGTNQYQKLDERKLELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLV
GQKSKGRRVLNLFSYTGSASVHAALGGAKSVTTVDMSNTYLAWAKENFALNNLSGKQYEF
VQADCLQWIRDCNEQYDLIFIDPPTFSNSKRMEDSFDVQRDHVNLLGMLIKLLSPNGELV
FSNNKRKFKMDTETLTKMKIKVQNIDDMTLPLDYKRNPHIHNTWLITHADK