Protein Info for SO1832 in Shewanella oneidensis MR-1

Name: ppiC-2
Annotation: peptidyl-prolyl cis-trans isomerase C (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00639: Rotamase
  • amino acids 13 to 89 (77 residues), 69 bits, E=5.9e-23
• PF13616: Rotamase_3
  • amino acids 14 to 90 (77 residues), 73.7 bits, E=1.9e-24

Best Hits

Swiss-Prot: 51% identical to PPIC_ECO57: Peptidyl-prolyl cis-trans isomerase C (ppiC) from Escherichia coli O157:H7

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 99% identity to she:Shewmr4_2456)

MetaCyc: 51% identical to peptidyl-prolyl cis-trans isomerase C (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

See Q8EFY2 at UniProt or InterPro

Protein Sequence (92 amino acids)

>SO1832 peptidyl-prolyl cis-trans isomerase C (NCBI ptt file) (Shewanella oneidensis MR-1)
MVQATARHLLVSSEDQCQALKQQILDGADFAQIARAHSSCPSGAQGGELGSFGPGMMVRE
FDEVVFSAPLNVVQGPVKTQFGYHLLEVTSRG