Protein Info for SO1812 in Shewanella oneidensis MR-1

Name: mdeA
Updated annotation (from data): Methionine gamma-lyase (EC 4.4.1.11)
Rationale: Specifically important for utilizing L-Methionine. Automated validation from mutant phenotype: the predicted function (4.4.1.11) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: methionine gamma-lyase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 11 to 396 (386 residues), 571.2 bits, E=5.2e-176
• PF01053: Cys_Met_Meta_PP
  • amino acids 12 to 393 (382 residues), 506 bits, E=1e-155
• PF01041: DegT_DnrJ_EryC1
  • amino acids 65 to 186 (122 residues), 39.1 bits, E=1.1e-13
• PF00155: Aminotran_1_2
  • amino acids 67 to 199 (133 residues), 27.9 bits, E=2.8e-10

Best Hits

Swiss-Prot: 55% identical to MEGL_FUSNP: L-methionine gamma-lyase (mgl) from Fusobacterium nucleatum subsp. polymorphum

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to son:SO_1812)

MetaCyc: 51% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

See Q8EG02 at UniProt or InterPro

Protein Sequence (397 amino acids)

>SO1812 Methionine gamma-lyase (EC 4.4.1.11) (Shewanella oneidensis MR-1)
MQDKSSKMWKAATQAIHAGHEREAFGSLVTPLYQTATFVFDSAQQGGERFAGNEPGYIYT
RLGNPTVAELERKMAILERAEAAAATASGMGAVSAALLANLQIGDHLVASNAVYGCTFAL
MTNQFARFGIEVTLVDFSDVELIERAIKPNTKVIFCETPVNPHLQVFDLSAIAAIAKRHS
LTSIVDNTFMTPLLQQPIALGIDVVVHSATKYLNGHGDVIAGIVCGSEAQLHRVKYEILK
DIGAVMSPHDAWLILRGLKTLDVRLQRHCESAQRVAEFLEQHPAVTRVYYPGLKSHSGHR
FIGQQMRRAGGVIAFELAADFTQAMAFVGNLKLFSIAVSLGDAESLIQHPASMTHSPYSP
EARAAAGIGDNLLRISVGLEDCDDIIADLSQALAALV