Protein Info for SO1787 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 191 (28 residues), see Phobius details PF04893: Yip1" amino acids 7 to 180 (174 residues), 137.9 bits, see alignment E=1.6e-44

Best Hits

Swiss-Prot: 38% identical to YOHC_ECOL6: Inner membrane protein YohC (yohC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to son:SO_1787)

Predicted SEED Role

"FIG01345364: inner membrane protein Yip1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG25 at UniProt or InterPro

Protein Sequence (198 amino acids)

>SO1787 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MILNHLMGLYTHPKQEWHAIEQNHEALKSSLSHVILIALIPAICSFIATAYIGWNPGAGD
PIYLTPQSAMFMSVGMYFGLIAGVFALAYLAFWMAKTFDAHPTFTQALELASYTATPLFM
VGLAALYPVLWFIMVVGLIGLAYSVYLLYAGVPIIMNIPEEKGFIYASSMVTAGLVLLVG
LMATSVILWSIGFGPMYQ