Protein Info for SO1778 in Shewanella oneidensis MR-1

Name: omcB
Annotation: decaheme cytochrome c (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03507: decaheme c-type cytochrome, OmcA/MtrC family" amino acids 57 to 670 (614 residues), 462.8 bits, see alignment E=1e-142 PF22111: MtrC-MtrF_N" amino acids 59 to 171 (113 residues), 100.4 bits, see alignment E=1.7e-32 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 178 to 320 (143 residues), 101.4 bits, see alignment E=1.1e-32 amino acids 535 to 667 (133 residues), 48.7 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1778)

Predicted SEED Role

"surface localized decaheme cytochrome c lipoprotein, MtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG34 at UniProt or InterPro

Protein Sequence (671 amino acids)

>SO1778 decaheme cytochrome c (NCBI ptt file) (Shewanella oneidensis MR-1)
MMNAQKSKIALLLAASAVTMALTGCGGSDGNNGNDGSDGGEPAGSIQTLNLDITKVSYEN
GAPMVTVFATNEADMPVIGLANLEIKKALQLIPEGATGPGNSANWQGLGSSKSYVDNKNG
SYTFKFDAFDSNKVFNAQLTQRFNVVSAAGKLADGTTVPVAEMVEDFDGQGNAPQYTKNI
VSHEVCASCHVEGEKIYHQATEVETCISCHTQEFADGRGKPHVAFSHLIHNVHNANKAWG
KDNKIPTVAQNIVQDNCQVCHVESDMLTEAKNWSRIPTMEVCSSCHVDIDFAAGKGHSQQ
LDNSNCIACHNSDWTAELHTAKTTATKNLINQYGIETTSTINTETKAATISVQVVDANGT
AVDLKTILPKVQRLEIITNVGPNNATLGYSGKDSIFAIKNGALDPKATINDAGKLVYTTT
KDLKLGQNGADSDTAFSFVGWSMCSSEGKFVDCADPAFDGVDVTKYTGMKADLAFATLSG
KAPSTRHVDSVNMTACANCHTAEFEIHKGKQHAGFVMTEQLSHTQDANGKAIVGLDACVT
CHTPDGTYSFANRGALELKLHKKHVEDAYGLIGGNCASCHSDFNLESFKKKGALNTAAAA
DKTGLYSTPITATCTTCHTVGSQYMVHTKETLESFGAVVDGTKDDATSAAQSETCFYCHT
PTVADHTKVKM