Protein Info for SO1742 in Shewanella oneidensis MR-1

Annotation: hypothetical 3-oxoacyl-acyl carrier protein synthase III (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF08541: ACP_syn_III_C" amino acids 260 to 349 (90 residues), 64 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 100% identical to OLEA_SHEON: Acyl-CoA:acyl-CoA alkyltransferase (oleA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 99% identity to she:Shewmr4_2548)

MetaCyc: 100% identical to fatty acyl-CoA transferase OleA (Shewanella oneidensis MR-1)
RXN-18560 [EC: 2.3.3.20]

Predicted SEED Role

"3-oxoacyl-[ACP] synthase III in alkane synthesis cluster"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180 or 2.3.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG66 at UniProt or InterPro

Protein Sequence (349 amino acids)

>SO1742 hypothetical 3-oxoacyl-acyl carrier protein synthase III (NCBI ptt file) (Shewanella oneidensis MR-1)
MKYSRVFINSLAYELAPVVVSSSELESRLAPLYQKFRIPMGQLAALTGITERRWWPKGHQ
LSDGAINAAHKAIAETGIDVAELGAVVYTGVCRDQHEPATACRIAAALGVSKDTAIYDIS
NACLGVLSGILDIANRIELGQIKAGMVVSCESARDIVDVTIDNMLADPTMQNFAQSLATL
TGGSGAVAVILTDGSLPLTNVRKHQLLGASHLSAPQHHQLCQWGLQEVGHNIYREFMRTD
AVTLLKEGVELAKHTWEHFLAQRNWLVEQVDKVICHQVGASNRKQVLSALNIPPEKEFPT
YQLLGNMGTVSLPVTAAMAHDQGFLRPGDQVSFLGIGSGLNCMMLGIKW