Protein Info for SO1724 in Shewanella oneidensis MR-1

Annotation: phosphate ABC transporter, permease protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 301 to 329 (29 residues), see Phobius details amino acids 341 to 368 (28 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details amino acids 439 to 461 (23 residues), see Phobius details amino acids 517 to 539 (23 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 252 to 544 (293 residues), 269.3 bits, see alignment E=1.6e-84 PF00528: BPD_transp_1" amino acids 320 to 544 (225 residues), 51.1 bits, see alignment E=7.2e-18

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to son:SO_1724)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG83 at UniProt or InterPro

Protein Sequence (552 amino acids)

>SO1724 phosphate ABC transporter, permease protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MGKWVKSGSPWIWMTGGAVSISLIAVLGLLLLIAWRGLSYFWPTTIYQWELEDSSGVRST
LIGEIYDREEVPTERLIAAGQVFKKDPGEFVTRYLVKTGNREFVGLDFRWILATDIVSRS
EPSEVAKLERAKNGNFYGYPVAVIENGKRLELANDVIEASLMEHIDRAVALSDKALKLQK
QDIGAINYEIERLRLKERGYELDGELTESLKAEFAAAKAALHQDYLVLEKELFALREQAA
RDSVIVRDMRGVEVELKLDAVLDVTYVNHLSLISKVKHWFVSMGRFLWDDPREANTEGGV
FPAIFGTVFMVLVMAVIVTPFGVIAAIYMHEYAKKGPITKIIRIAVINLAGVPSIVYGVF
GLGFFVYMMGGTIDQLFYAEALPAPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPS
AVRQGSLALGATKAETLWRIVIPMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLP
LDFNFPFVHLERKFMHLGFHIYDVGFQSPNVEAARPLVYATSFLLVTVIMALNLTAISVR
NHLREKYRSLEH