Protein Info for SO1707 in Shewanella oneidensis MR-1

Annotation: ABC transporter, permease protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 350 to 368 (19 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 6 to 338 (333 residues), 53.6 bits, see alignment E=3e-18 PF12698: ABC2_membrane_3" amino acids 25 to 364 (340 residues), 160.7 bits, see alignment E=8.3e-51 PF01061: ABC2_membrane" amino acids 173 to 337 (165 residues), 110.8 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to son:SO_1707)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG99 at UniProt or InterPro

Protein Sequence (373 amino acids)

>SO1707 ABC transporter, permease protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLRRIWAVVVKELRQLSRDRMTFGMIVMIPLVQLMLFGYAINTDARHLPAGLVNLSDSSY
SRALVKAVEATQVVDFKRSYSSAAQAEAAITRGEVKAVLYLGADLDERLVRHPAFAGQAY
FAEPVGQWLVDGSDTVVASTIRSLRQMPLDEITGRTLKSNPPSFEVVQYFNPEQRSVVNI
VPGLLGVILTMTMVMFTSAAIVREREQGNMEFLITTPVRPLELMLGKITPYVLVGFVQVT
IILSAGHLLFDVPIRGGIDSIAFAAMLFICASLTLGLVISTIAKTQLQSMQMTVFILLPS
ILLSGFMFPYEAMPVAAQWIAEALPATHFMRMSRAIVLRDAEVSDLQFDALWMIGFTCLG
LLVASLRFSKRLD