Protein Info for SO1683 in Shewanella oneidensis MR-1
Updated annotation (from data): 3-hydroxy-2-methylbutyryl-CoA dehydrogenase IvdG (EC:1.1.1.178)
Rationale: Important for utilization of L-isoleucine as a carbon or nitrogen source. SO1683 is expected to be the 3-hydroxy-2-methylbutyryl-CoA dehydrogenase for isoleucine degradation (PMC2612455), and this is confirmed by its mutants' phenotype. (Also see data from an independent set of transposon mutants in PMC3219624.) Mutants in SO1683 have many other phenotypes which are not explained.
Original annotation: 3-oxoacyl-(acyl-carrier-protein) reductase, putative (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 32% identical to BAIA2_CLOSV: 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 2 (baiA2) from Clostridium scindens (strain JCM 10418 / VPI 12708)
KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to son:SO_1683)MetaCyc: 32% identical to 3alpha-hydroxysteroid dehydrogenase 2 ([Clostridium] scindens)
3OHSTEROXRED-RXN [EC: 1.1.1.395]; 1.1.1.395 [EC: 1.1.1.395]; 1.1.1.395 [EC: 1.1.1.395]; 1.1.1.395 [EC: 1.1.1.395]
Predicted SEED Role
"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
- biotin biosynthesis I (14/15 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
- (5Z)-dodecenoate biosynthesis I (6/6 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
- (5Z)-dodecenoate biosynthesis II (5/6 steps found)
- L-isoleucine degradation I (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
- cis-vaccenate biosynthesis (4/5 steps found)
- fatty acid elongation -- saturated (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- palmitate biosynthesis III (21/29 steps found)
- propanoate fermentation to 2-methylbutanoate (4/6 steps found)
- stearate biosynthesis IV (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- petroselinate biosynthesis (2/6 steps found)
- 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- bile acid 7α-dehydroxylation (2/16 steps found)
- mycolate biosynthesis (20/205 steps found)
- superpathway of mycolate biosynthesis (21/239 steps found)
KEGG Metabolic Maps
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.100
Use Curated BLAST to search for 1.1.1.100 or 1.1.1.178 or 1.1.1.395
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EGC1 at UniProt or InterPro
Protein Sequence (252 amino acids)
>SO1683 3-hydroxy-2-methylbutyryl-CoA dehydrogenase IvdG (EC:1.1.1.178) (Shewanella oneidensis MR-1) MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGSSTEVQGYAL DITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVINV NLTGTFLCGREAAAAMIESGQAGVIVNISSLAKAGNVGQSNYAASKAGVAAMSVGWAKEL ARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIENDYVN GRVFEVDGGIRL