Protein Info for SO1680 in Shewanella oneidensis MR-1

Annotation: enoyl-CoA hydratase/isomerase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 12 to 256 (245 residues), 185.6 bits, E=1.1e-58
• PF16113: ECH_2
  • amino acids 13 to 185 (173 residues), 92.2 bits, E=4.7e-30

Best Hits

Swiss-Prot: 38% identical to HPCD_METS5: 3-hydroxypropionyl-coenzyme A dehydratase (Msed_2001) from Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to son:SO_1680)

MetaCyc: 38% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) / Enoyl-CoA hydratase [isoleucine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• fatty acid salvage (6/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
• L-valine degradation I (7/8 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• L-isoleucine degradation I (5/6 steps found)
• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• adipate degradation (4/5 steps found)
• β-alanine biosynthesis II (4/6 steps found)
• propanoate fermentation to 2-methylbutanoate (4/6 steps found)
• valproate β-oxidation (6/9 steps found)
• adipate biosynthesis (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• propanoyl-CoA degradation II (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• acrylate degradation II (1/3 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• acrylate degradation I (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• phenylacetate degradation I (aerobic) (2/9 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• superpathway of phenylethylamine degradation (3/11 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• 3-hydroxypropanoate cycle (4/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (7/18 steps found)
• glyoxylate assimilation (3/13 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• L-tryptophan degradation III (eukaryotic) (3/15 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• superpathway of the 3-hydroxypropanoate cycle (4/18 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

See Q8EGC4 at UniProt or InterPro

Protein Sequence (257 amino acids)

>SO1680 enoyl-CoA hydratase/isomerase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDYLVERIEGHTAILTMNNPPANTWTAQSLQALKAKVLELNANKDIYALVLTGEGNKFFS
AGADLKLFSDGDKGNAASMAKHFGEAFETLSQFRGVSIAAINGYAMGGGLEVALACDIRI
AETQAVMALPEATVGLLPCAGGTQNLTALVGEGWAKRMILCGERVNAAQALNLRLVEEVV
ETGEALNAAIALAAKVANQSPSSVTACKTLIQAGRQMPRSQALPIEHELFVGLFDTEDQA
EGVNAFLEKRKADWKNR