Protein Info for SO1676 in Shewanella oneidensis MR-1

Name: metA
Annotation: homoserine O-succinyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01001: homoserine O-succinyltransferase
  • amino acids 1 to 301 (301 residues), 466.8 bits, E=1.9e-144
• PF04204: HTS
  • amino acids 2 to 299 (298 residues), 455.9 bits, E=2.7e-141

Best Hits

Swiss-Prot: 100% identical to METAS_SHEON: Homoserine O-succinyltransferase (metAS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00651, homoserine O-succinyltransferase [EC: 2.3.1.46] (inferred from 100% identity to son:SO_1676)

MetaCyc: 54% identical to homoserine O-succinyltransferase (Escherichia coli K-12 substr. MG1655)
Homoserine O-succinyltransferase. [EC: 2.3.1.46]

Predicted SEED Role

"Homoserine O-succinyltransferase (EC 2.3.1.46)" in subsystem Methionine Biosynthesis (EC 2.3.1.46)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis I (4/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.46

Sequence Analysis Tools

See Q8EGC8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SO1676 homoserine O-succinyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MPVKIPDHLPAAGILESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN
TPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFEDVRHKNYDGLIITGAPLGQIDFEDVTY
WDHIREIIDWSQQHVTSVLFLCWAAHAGLYHLYGLNRKILEQKRSGVFVHRRTCQHFPLL
RGFDDEFFAPHSRFAEMDVEEIRQHPQLQLLAESDEAGAYLVLSRNNRNLFVMGHPEYQK
STLNDEYHRDLAQSLNPNVPQNYYRNDDPKADAIARWHSHGSLLVSNWLNYYVYQLTPYD
LSDMTAMTPWESQ